Recombinant Human GABA(A) receptor-associated protein, His-tagged
Cat.No. : | GABARAP-4365H |
Product Overview : | GABARAP Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 137 amino acids (1-117 a.a.) and having a molecular mass of 16 kDa. GABARAP is fused to a 20 amino acid His-Tag at N-Terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
Cat. No. : | GABARAP-4365H |
Description : | GABARAP is a ligand-gated chloride channel that mediates inhibitory neurotransmission. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. |
Source : | Human |
Host : | Escherichia Coli |
Form : | GABARAP solution containing 20mM Tris pH-8, 0.2M NaCl and 20% glycerol. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Physical Appearance : | Sterile filtered colorless solution. |
Amino Acid Sequence : | MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSE GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVG QFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH EEDFFLYIAYSDESVYGL. |
Storage : | GABARAP Human Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
Pathways : | Regulation of autophagy |
Functions : | GABA receptor binding; beta-tubulin binding; microtubule binding; protein binding |
Gene Name : | GABARAP GABA(A) receptor-associated protein [ Homo sapiens ] |
Official Symbol : | GABARAP |
Synonyms : | GABARAP; GABA(A) receptor-associated protein; MM46; FLJ25768; MGC120154; MGC120155; Gamma-aminobutyric acid receptor-associated protein; FLC3B |
Gene ID : | 11337 |
mRNA Refseq : | NM_007278 |
Protein Refseq : | NP_009209 |
MIM : | 605125 |
UniProt ID : | O95166 |
Chromosome Location : | 17 |
Products Types
◆ Recombinant Protein | ||
GABARAP-937H | Recombinant Human GABARAP Protein, GST-tagged | +Inquiry |
GABARAP-1607R | Recombinant Rhesus Macaque GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAP-3421M | Recombinant Mouse GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAP-2096R | Recombinant Rat GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAP-288H | Recombinant Human GABARAP protein(Met1-Leu117), His&MBP-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket