Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human SHBG protein, His-tagged

Recombinant Human SHBG protein, His-tagged

   Share
"SHBG" Related Products.
By Species
Human(18)
Mouse(7)
Rat(5)
Zebrafish(1)
By Source
+Expand -Collapse
By Tag
His(7)
N/A(2)
Cat.No.:
SHBG-3742H
Product Overview:
Recombinant human SHBG was expressed in CHO cells with C-Terminal His-tag + myc-epitope.
Description:
Sex-hormone-binding globulin (SHBG) is a beta-globulin that specifically binds steroid hormones. Its molecular weight is 86 kDa/mol. The major site of SHBG synthesis is thought to be the hepatocytes. Its production is regulated by androgen/estrogen balance, thyroid hormones, insulin and dietary factors, among others. SHBG is involved in the transport of sex steroids in plasma. Its concentration is a major factor regulating their distribution between protein-bound and free states. Determination of SHBG concentration is mainly of importance in the evaluation of mild disorders of androgen metabolism and it allows identification of women with hirsutism who are likely to respond to estrogen therapy. Testosterone/SHBG-ratios correlate well with both measured and calculated values for free testosterone, and help to discriminate between subjects with excessive androgen activity and normal individuals.
Source:
CHO
Species:
Human
Tag :
His
Form:
Frozen, stabilized and concentrated medium
Molecular Mass:
46.79 kDa (calculated); 94kDa (forms a dimer)
Protein length:
428 AA
AA Sequence:
AAQPARRARRTKLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHSRGGPEQKLISEEDLNSAVDHHHHHH
Applications:
ELISA standard; Standard for Immunoanalytical methods
Notes:
This product is intended for research use only.
Storage:
Store at -80 centigrade.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.