"SHBG" Related Products

Expand
Expand

Recombinant Human SHBG protein, His-tagged

Cat.No.: SHBG-3742H
Product Overview: Recombinant human SHBG was expressed in CHO cells with C-Terminal His-tag + myc-epitope.
Description: Sex-hormone-binding globulin (SHBG) is a beta-globulin that specifically binds steroid hormones. Its molecular weight is 86 kDa/mol. The major site of SHBG synthesis is thought to be the hepatocytes. Its production is regulated by androgen/estrogen balance, thyroid hormones, insulin and dietary factors, among others. SHBG is involved in the transport of sex steroids in plasma. Its concentration is a major factor regulating their distribution between protein-bound and free states. Determination of SHBG concentration is mainly of importance in the evaluation of mild disorders of androgen metabolism and it allows identification of women with hirsutism who are likely to respond to estrogen therapy. Testosterone/SHBG-ratios correlate well with both measured and calculated values for free testosterone, and help to discriminate between subjects with excessive androgen activity and normal individuals.
Source: CHO
Species: Human
Tag : His
Form: Frozen, stabilized and concentrated medium
Molecular Mass: 46.79 kDa (calculated); 94kDa (forms a dimer)
Protein length: 428 AA
AA Sequence: AAQPARRARRTKLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHSRGGPEQKLISEEDLNSAVDHHHHHH
Applications: ELISA standard; Standard for Immunoanalytical methods
Notes: This product is intended for research use only.
Storage: Store at -80 centigrade.
Gene Name: Sex hormone binding globulin [Homo sapiens (human)]
Official Symbol: SHBG
Synonyms: ABP; SBP; TEBG; SHBG, Sex steroid-binding protein; Testisspecific androgen-binding protein; Testosterone-estradiolbinding globulin; Testosterone-estrogen-binding globulin
Gene ID: 6462
mRNA Refseq: NM_001040.3
Protein Refseq: NP_001031.2
MIM: 182205
UniProt ID: P04278

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.