| Cat. No. | CABT-19790MH |
| Antigen Description | This gene encodes a Ras-related protein that enriched in striatum. The product of this gene binds to GTP and possesses intrinsic GTPase activity. The gene belongs to the Ras superfamily of small GTPases. The exact function of this gene is unknown, but most striatum-specific mRNAs characterized to date encode components of signal transduction cascades. |
| Product Overview | Mouse monoclonal antibody raised against a full-length recombinant RASD2. |
| Immunogen | RASD2 (AAH13419, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2b Kappa |
| Application | Western Blot, Immunoprecipitation, ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIGSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREG |
| Reactivity | Human |
| Clone | 2D8 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | RASD2 RASD family, member 2 [Homo sapiens] |
| Official symbol | RASD2 |
| Synonyms | RASD family, member 2; Tumor endothelial marker 2; TEM2; Ras homolog enriched in striatum; MGC:4834; GTP-binding protein Rhes; Rhes; OTTHUMP00000197925 |
| GeneId | 23551 |
| mRNA Refseq | NM_014310 |
| Protein Refseq | NP_055125 |
| MIM | 612842 |
| Uniprot ID | Q96D21 |
| Chromosome Location | 22q13.1 |
| Function | G-protein beta-subunit binding; GTP binding; GTPase activity; nucleotide binding; phosphatidylinositol 3-kinase binding; ubiquitin conjugating enzyme binding |
Download Datasheet: |