| Cat. No. | CABT-21833MH |
| Antigen Description | The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant CCRK. |
| Immunogen | CCRK (AAH02655, 183 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA |
| Reactivity | Human |
| Clone | 4F22 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | CDK20 cyclin-dependent kinase 20 [Homo sapiens] |
| Official symbol | CCRK |
| Synonyms | P42; CCRK; CDCH; PNQALRE; cyclin-dependent kinase 20; CAK-kinase p42; OTTHUMP00000021607; OTTHUMP00000123392; OTTHUMP00000123393; CDK-activating kinase p42; cell cycle-related kinase; cell division protein kinase 20; cyclin-dependent protein kinase H; cyclin-kinase-activating kinase p42 |
| GeneId | 23552 |
| mRNA Refseq | NM_001039803 |
| Protein Refseq | NP_001034892 |
| MIM | 610076 |
| Uniprot ID | Q8IZL9 |
| Chromosome Location | 9q22.1 |
| Function | ATP binding; cyclin-dependent protein kinase activity; nucleotide binding |
Download Datasheet: |