| Cat. No. | CABT-11812MH |
| Antigen Description | N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. |
| Product Overview | Mouse monoclonal antibody raised against a full length recombinant NNMT. |
| Immunogen | NNMT (AAH00234, 1 a.a. ~ 265 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG1 Kappa |
| Application | Western Blot, Immunoprecipitation, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
| Reactivity | Human |
| Clone | 3G3 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | NNMT nicotinamide N-methyltransferase [Homo sapiens] |
| Official symbol | NNMT |
| Synonyms | nicotinamide N-methyltransferase; EC 2.1.1.1; OTTHUMP00000238385 |
| GeneId | 4837 |
| mRNA Refseq | NM_006169 |
| Protein Refseq | NP_006160 |
| MIM | 600008 |
| Uniprot ID | Q6FH49 |
| Chromosome Location | 11q23.1 |
| Pathway | Biological oxidations, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Methylation, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem; Phase II conjugation, organism-specific biosystem |
| Function | methyltransferase activity; nicotinamide N-methyltransferase activity; pyridine N-methyltransferase activity; transferase activity |
Download Datasheet: |