| Cat. No. | CABT-13646MH |
| Antigen Description | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5" UTR but that encode the same protein have been identified for this gene. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant YWHAZ. |
| Immunogen | YWHAZ (NP_003397.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG1 Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ |
| Reactivity | Human |
| Clone | 2C4 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Homo sapiens] |
| Official symbol | YWHAZ |
| Synonyms | YWHAD; KCIP-1; MGC111427; MGC126532; MGC138156; 14-3-3-zeta; 14-3-3 protein zeta/delta; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; OTTHUMP00000165851; OTTHUMP00000165852; OTTHUMP00000165854; OTTHUMP00000165857; OTTHUMP00000165858; OTTHUMP00000165859; OTTHUMP00000165860; OTTHUMP00000227482; OTTHUMP00000227483; OTTHUMP00000227485; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide |
| GeneId | 7534 |
| mRNA Refseq | NM_001135699 |
| Protein Refseq | NP_001129171 |
| MIM | 601288 |
| Uniprot ID | P63104 |
| Chromosome Location | 8q23.1 |
| Pathway | Adaptive Immunity Signaling, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem |
| Function | protein binding; protein domain specific binding; transcription factor binding |
Download Datasheet: |