| Cat. No. | CABT-13890MH |
| Antigen Description | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. |
| Product Overview | Mouse monoclonal antibody raised against a full-length recombinant FOXC2. |
| Immunogen | FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL |
| Reactivity | Human |
| Clone | 2E5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | FOXC2 forkhead box C2 (MFH-1, mesenchyme forkhead 1) [Homo sapiens] |
| Official symbol | FOXC2 |
| Synonyms | forkhead box C2 (MFH-1, mesenchyme forkhead 1); Transcription factor FKH-14; FKHL14; LD; MFH1; forkhead box protein C2; MFH-1; forkhead, Drosophila, homolog-like 14; Forkhead-related protein FKHL14; MFH-1,mesenchyme forkhead 1; Mesenchyme fork head protein 1; MFH-1 protein; OTTHUMP00000175007 |
| GeneId | 2303 |
| mRNA Refseq | NM_005251 |
| Protein Refseq | NP_005242 |
| MIM | 602402 |
| Uniprot ID | Q99958 |
| Chromosome Location | 16q24.1 |
| Pathway | Adipogenesis, organism-specific biosystem; Heart Development, organism-specific biosystem |
| Function | DNA bending activity; chromatin DNA binding; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding |
Download Datasheet: |