| Cat. No. | CABT-13929MH |
| Antigen Description | This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. |
| Product Overview | Mouse monoclonal antibody raised against a full-length recombinant HOXB9. |
| Immunogen | HOXB9 (NP_076922, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, Immunoprecipitation, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG |
| Reactivity | Human |
| Clone | 5D22 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | HOXB9 homeobox B9 [Homo sapiens] |
| Official symbol | HOXB9 |
| Synonyms | homeobox B9; HOX-2.5; HOX2E; HOX2; homeo box B9; homeo box 2E; Homeobox protein Hox-2.5; homeobox protein Hox-B9; Homeobox protein Hox-2E; OTTHUMP00000216946 |
| GeneId | 3219 |
| mRNA Refseq | NM_024017 |
| Protein Refseq | NP_076922 |
| MIM | 142964 |
| Uniprot ID | P17482 |
| Chromosome Location | 17q21.3 |
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity |
Download Datasheet: |