| Cat. No. | CABT-14293MH |
| Antigen Description | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the development of hair, nail, and filiform papilla. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant HOXC13. |
| Immunogen | HOXC13 (NP_059106, 132 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG1 Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSK* |
| Reactivity | Human |
| Clone | 21E5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | HOXC13 homeobox C13 [Homo sapiens] |
| Official symbol | HOXC13 |
| Synonyms | homeobox C13; HOX3; HOX3G; homeo box C13; homeo box 3G; Homeobox protein Hox-3G; homeobox protein Hox-C13; NUP98/HOXC13; OTTHUMP00000217349 |
| GeneId | 3229 |
| mRNA Refseq | NM_017410 |
| Protein Refseq | NP_059106 |
| MIM | 142976 |
| Uniprot ID | P31276 |
| Chromosome Location | 12q13.3 |
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity |
Download Datasheet: |