| Cat. No. | CABT-14491MH |
| Antigen Description | The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant PIK3C2B. |
| Immunogen | PIK3C2B (NP_002637, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, ELISA |
| Storage Buffer | In ascites fluid |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQG* |
| Reactivity | Human |
| Clone | 2I5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | PIK3C2B phosphoinositide-3-kinase, class 2, beta polypeptide [Homo sapiens] |
| Official symbol | PIK3C2B |
| Synonyms | phosphoinositide-3-kinase, class 2, beta polypeptide; EC 2.7.1.154; C2-PI3K; DKFZp686G16234; PI3K-C2beta; phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide; Phosphoinositide 3-kinase-C2-beta; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta; PtdIns-3-kinase C2 subunit beta; PTDINS-3-kinase C2 beta; PI3K-C2-beta; EC 2.7.1; OTTHUMP00000034333 |
| GeneId | 5287 |
| mRNA Refseq | NM_002646 |
| Protein Refseq | NP_002637 |
| MIM | 602838 |
| Uniprot ID | O00750 |
| Chromosome Location | 1q32 |
| Pathway | 3-phosphoinositide biosynthesis, conserved biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Phosphatidylinositol signaling system, organism-specific biosystem |
| Function | 1-phosphatidylinositol-3-kinase activity; ATP binding; inositol or phosphatidylinositol kinase activity; lipid kinase activity; nucleotide binding; phosphatidylinositol binding; phosphatidylinositol-4-phosphate 3-kinase activity; phosphotransferase activity, alcohol group as acceptor; protein binding |
Download Datasheet: |