| Cat. No. | CABT-14935MH |
| Antigen Description | Ena/VASP-like protein is a member of the Ena/VASP family of proteins that in humans is encoded by the EVL gene. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant EVL. |
| Immunogen | EVL (NP_057421, 309 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT* |
| Reactivity | Human |
| Clone | 2E7 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | EVL Enah/Vasp-like [Homo sapiens] |
| Official symbol | EVL |
| Synonyms | Enah/Vasp-like; RNB6; Ena/vasodilator-stimulated phosphoprotein-like; ena/VASP-like protein |
| GeneId | 51466 |
| mRNA Refseq | NM_016337 |
| Protein Refseq | NP_057421 |
| Uniprot ID | Q9UI08 |
| Chromosome Location | 14q32.2 |
| Pathway | Adaptive Immunity Signaling, organism-specific biosystem; Axon guidance, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem; Signaling by Robo receptor, organism-specific biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem |
| Function | SH3 domain binding; actin binding; profilin binding; protein binding |
Download Datasheet: |