| Cat. No. | CABT-16267MH |
| Antigen Description | This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. A related pseudogene has been identified on chromosome 13. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant SP3. |
| Immunogen | SP3 (NP_003102, 516 a.a. ~ 616 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2b Kappa |
| Application | Western Blot, Immunofluorescence, ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL* |
| Reactivity | Human |
| Clone | 4I8 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | SP3 Sp3 transcription factor [Homo sapiens] |
| Official symbol | SP3 |
| Synonyms | Sp3 transcription factor; SPR2; SPR-2; GC-binding transcription factor Sp3; DKFZp686O1631; specificity protein 3; OTTHUMP00000205122; transcription factor Sp3; OTTHUMP00000163171; OTTHUMP00000220849 |
| GeneId | 6670 |
| mRNA Refseq | NM_001017371 |
| Protein Refseq | NP_001017371 |
| MIM | 601804 |
| Uniprot ID | Q59FX5 |
| Chromosome Location | 2q31 |
| Pathway | Regulation of Telomerase, organism-specific biosystem; Selenium Metabolism and Selenoproteins, organism-specific biosystem |
| Function | DNA binding; chromatin binding; double-stranded DNA binding; metal ion binding; protein binding; zinc ion binding |
Download Datasheet: |