| Cat. No. | CABT-17204MH |
| Antigen Description | This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. |
| Product Overview | Mouse monoclonal antibody raised against a full length recombinant POLR2H. |
| Immunogen | POLR2H (AAH00739, 1 a.a. ~ 151 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG1 Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF* |
| Reactivity | Human |
| Clone | 4H72B5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | POLR2H polymerase (RNA) II (DNA directed) polypeptide H [Homo sapiens] |
| Official symbol | POLR2H |
| Synonyms | polymerase (RNA) II (DNA directed) polypeptide H; OTTHUMP00000210507; RPB8; OTTHUMP00000210508; RPB17; OTTHUMP00000210509; DNA-directed RNA polymerase II subunit H; OTTHUMP00000210511; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; OTTHUMP00000210512; hRPB8; RPABC3; RNA polymerases I, II, and III subunit ABC3; DNA-directed RNA polymerases I, II, and III subunit RPABC3; RPB8 homolog; hsRPB8; OTTHUMP00000210505 |
| GeneId | 5437 |
| mRNA Refseq | NM_006232 |
| Protein Refseq | NP_006223 |
| MIM | 606023 |
| Uniprot ID | P52434 |
| Chromosome Location | 3q28 |
| Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem |
| Function | DNA-directed RNA polymerase activity; protein binding; contributes_to protein kinase activity; zinc ion binding |
Download Datasheet: |