| Cat. No. | CABT-17319MH |
| Antigen Description | Replication protein A 14 kDa subunit is a protein that in humans is encoded by the RPA3 gene. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant RPA3. |
| Immunogen | RPA3 (AAH05264, 12 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG1 lambda |
| Application | Western Blot, Immunohistochemistry, Sandwich ELISA, RNAi Knockdown |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD |
| Reactivity | Human |
| Clone | 2G5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | RPA3 replication protein A3, 14kDa [Homo sapiens] |
| Official symbol | RPA3 |
| Synonyms | REPA3; replication protein A 14 kDa subunit; RP-A p14; RF-A protein 3; OTTHUMP00000200929; replication factor A protein 3 |
| GeneId | 6119 |
| mRNA Refseq | NM_002947 |
| Protein Refseq | NP_002938 |
| MIM | 179837 |
| Uniprot ID | P35244 |
| Chromosome Location | 7p22 |
| Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the RAD51-ssDNA nucleoprotein complex, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem |
| Function | protein binding; single-stranded DNA binding |
Download Datasheet: |