| Cat. No. | CABT-19088MH |
| Antigen Description | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant TSPAN1. |
| Immunogen | TSPAN1 (NP_005718, 110 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN* |
| Reactivity | Human |
| Clone | 4C5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | TSPAN1 tetraspanin 1 [Homo sapiens] |
| Official symbol | TSPAN1 |
| Synonyms | tetraspanin 1; TM4SF; NET1; tetraspan 1; NET-1; tetraspanin-1; OTTHUMP00000008900; Tetraspan NET-1; TM4C; Tetraspanin TM4-C |
| GeneId | 10103 |
| mRNA Refseq | NM_005727 |
| Protein Refseq | NP_005718 |
| MIM | 613170 |
| Uniprot ID | O60635 |
| Chromosome Location | 1p34.1 |
Download Datasheet: |