| Cat. No. | CABT-21148MH |
| Antigen Description | This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant APOL3. |
| Immunogen | APOL3 (NP_663615, 240 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG* |
| Reactivity | Human |
| Clone | 9G6 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | APOL3 apolipoprotein L, 3 [Homo sapiens] |
| Official symbol | APOL3 |
| Synonyms | apolipoprotein L, 3; CG121; APOLIII; OTTHUMP00000198072; Apolipoprotein L-III; apoL-III; CG12_1; apolipoprotein L3; TNF-inducible protein CG12-1; CG12-1; OTTHUMP00000198071; OTTHUMP00000198073 |
| GeneId | 80833 |
| mRNA Refseq | NM_145640 |
| Protein Refseq | NP_663615 |
| MIM | 607253 |
| Uniprot ID | O95236 |
| Chromosome Location | 22q13.1 |
| Function | lipid binding; lipid transporter activity; signal transducer activity |
Download Datasheet: |