| Cat. No. | CABT-21858MH |
| Antigen Description | The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant PRKD2. |
| Immunogen | PRKD2 (-, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2b Kappa |
| Application | Western Blot, Immunohistochemistry, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | MDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVE |
| Reactivity | Human |
| Clone | 3F5 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | PRKD2 protein kinase D2 [Homo sapiens] |
| Official symbol | PRKD2 |
| Synonyms | protein kinase D2; DKFZP586E0820; PKD2; HSPC187; nPKC-D2; serine/threonine-protein kinase D2; EC 2.7.11.13; EC 2.7.11 |
| GeneId | 25865 |
| mRNA Refseq | NM_001079880 |
| Protein Refseq | NP_001073349 |
| MIM | 607074 |
| Uniprot ID | Q9BZL6 |
| Chromosome Location | 19q13.3 |
| Pathway | T Cell Receptor Signaling Pathway, organism-specific biosystem |
| Function | ATP binding; metal ion binding; nucleotide binding; protein kinase C activity; protein kinase activity; protein serine/threonine kinase activity |
Download Datasheet: |