| Cat. No. | CABT-22956MH |
| Antigen Description | Synaptotagmins, like SYT2, are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (Hilbush and Morgan, 1994 |
| Product Overview | Mouse monoclonal antibody raised against a partial recombinant SYT2. |
| Immunogen | SYT2 (NP_796376, 311 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, Sandwich ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKN* |
| Reactivity | Human |
| Clone | 2H21 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | SYT2 synaptotagmin II [Homo sapiens] |
| Official symbol | SYT2 |
| Synonyms | synaptotagmin II; SytII; FLJ42519; synaptotagmin 2; synaptotagmin-2; OTTHUMP00000038803; OTTHUMP00000038804 |
| GeneId | 127833 |
| mRNA Refseq | NM_001136504 |
| Protein Refseq | NP_001129976 |
| MIM | 600104 |
| Uniprot ID | Q8N9I0 |
| Chromosome Location | 1q32.1 |
| Pathway | Botulinum neurotoxicity, organism-specific biosystem; Translocation of BoNT Light chain, organism-specific biosystem |
| Function | calcium ion binding; calcium-dependent phospholipid binding; protein binding; transporter activity |
Download Datasheet: |