| Cat. No. | CABT-23042MH |
| Antigen Description | This gene encodes a protein that is thought to function as a transcription factor. The protein is a cancer-associated antigen that can stimulate autologous T-cell responses, and it is therefore considered to be a potential immunotherapeutic target for the treatment of various hematopoietic malignancies, including diffuse large B-cell lymphoma. |
| Product Overview | Mouse monoclonal antibody raised against a full length recombinant PASD1. |
| Immunogen | PASD1 (NP_775764, 1 a.a. ~ 100 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2a Kappa |
| Application | Western Blot, ELISA |
| Storage Buffer | In 1x PBS, pH 7.2 |
| Storage Instruction | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Sequence | MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL |
| Reactivity | Human |
| Clone | 4D2 |
| Host | Mouse |
| Antigen Gene Information | Gene Name | PASD1 PAS domain containing 1 [Homo sapiens] |
| Official symbol | PASD1 |
| Synonyms | PAS domain containing 1; CT63; Cancer/testis antigen 63; OXTES1; PAS domain-containing protein 1; OX-TES-1; OTTHUMP00000025872 |
| GeneId | 139135 |
| mRNA Refseq | NM_173493 |
| Protein Refseq | NP_775764 |
| Uniprot ID | Q8IV76 |
| Chromosome Location | Xq28 |
| Function | signal transducer activity |
Download Datasheet: |