Recombinant Human TG, GST-tagged
Cat.No. : | TG-8266H |
Product Overview : | Human TG partial ORF ( NP_003226, 2671 a.a. - 2768 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. |
Source : | Wheat germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 36.52 kDa |
AA Sequence : | PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWS KYISSLKTSADGAKGGQSAESEEEE LTAGSGLREDLLSLQEPGSKTYSK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | TG thyroglobulin [ Homo sapiens (human) ] |
Official Symbol : | TG |
Synonyms : | TG; TGN; AITD3; thyroglobulin |
Gene ID : | 7038 |
mRNA Refseq : | NM_003235 |
Protein Refseq : | NP_003226 |
MIM : | 188450 |
UniProt ID : | P01266 |
Chromosome Location : | 8q24 |
Pathway : | Autoimmune thyroid disease; Thyroid hormone synthesis |
Function : | NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding |
Products Types
◆ Recombinant Protein | ||
Tg-6386M | Recombinant Mouse Tg Protein, Myc/DDK-tagged | +Inquiry |
TG-2112R | Recombinant Rat TG Protein (21-300 aa), His-SUMO-tagged | +Inquiry |
TG-0056H | Recombinant Human TG Protein | +Inquiry |
Tg-2125R | Recombinant Rat Tg Protein, His-tagged | +Inquiry |
TG-708H | Recombinant Human TG Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Protein | ||
TG-393H | Native Human Thyroglobulin | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
◆ Assay kits | ||
Kit-2277 | Transglutaminase Inhibitor Screening Assay Kit | +Inquiry |
Kit-0814 | Transglutaminase Activity Colorimetric Assay Kit | +Inquiry |
Kit-2036 | Triglyceride Colorimetric Assay Kit | +Inquiry |
Kit-0815 | Triglyceride Quantification Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket