"ENT1" Related Products

Recombinant Human SLC29A1 protein, GST-tagged

Cat.No.: ENT1-12465H
Product Overview: Recombinant Human SLC29A1(150-456 aa) fused with GST tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: GST
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass: 61 kDa
Protein length: 150-456 aa
AA Sequence: INSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFITACAVIILTIICYL GLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILKNISVLAFSVCFI FTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAVFMWPGKDSRWLPSLVLARLVFVPL LLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPKKVKPAEAETAGAIMAFFLCLGLALGAVFS FLFRAIV
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: SLC29A1 solute carrier family 29 (nucleoside transporters), member 1 [ Homo sapiens ]
Official Symbol: SLC29A1
Synonyms: SLC29A1; solute carrier family 29 (nucleoside transporters), member 1; ENT1; equilibrative nucleoside transporter 1; nucleoside transporter, es-type; solute carrier family 29 member 1; solute carrier family 29, member 1; equilibrative NBMPR-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside (NBMPR)-sensitive nucleoside transporter; MGC1465; MGC3778;
Gene ID: 2030
mRNA Refseq: NM_001078174
Protein Refseq: NP_001071642
MIM: 602193
UniProt ID: Q99808
Chromosome Location: 6p21.1
Pathway: Fluoropyrimidine Activity, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane, organism-specific biosystem; Transport of vitamins, nucleosides, and related molecules, organism-specific biosystem;
Function: nucleoside transmembrane transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.