Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CRH, GST-tagged

Cat.No. : CRH-108H
Product Overview : Human CRH partial ORF ( AAH11031, 154 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : Alpha-ketoglutarate-dependent dioxygenase FTO, also known as Fat mass and obesity-associated protein, FTO and KIAA1752, is a nucleus protein which belongs to the fto family. FTO is ubiquitously expressed, with relatively high expression in adrenal glands and brain; especially in hypothalamus and pituitary. FTO is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. FTO has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. It has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. FTO has no activity towards 1-methylguanine. It has no detectable activity towards double-stranded DNA. FTO requires molecular oxygen, alpha-ketoglutarate and iron. FTO contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. It contributes to the regulation of body size and body fat accumulation as well. Defects in FTO are the cause of growth retardation developmental delay coarse facies and early death. The disease consists of a severe children multiple congenital anomaly syndrome with death by the age of 3 years. All affected individuals had postnatal growth retardation, microcephaly, severe psychomotor delay, functional brain deficits, and characteristic facial dysmorphism.
Source : wheat germ
Species : Human
Tag : GST
Form : Liquid
Molecular Mass : 30.47 kDa
AA Sequence : SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CRH corticotropin releasing hormone [ Homo sapiens ]
Official Symbol : CRH
Synonyms : CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; CRF; corticotropin-releasing factor;
Gene ID : 1392
mRNA Refseq : NM_000756
Protein Refseq : NP_000747
MIM : 122560
UniProt ID : P06850
Chromosome Location : 8q13
Pathway : Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Long-term depression, organism-specific biosystem; Long-term depression, conserved biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem;
Function : corticotropin-releasing hormone activity; corticotropin-releasing hormone receptor 1 binding; corticotropin-releasing hormone receptor 2 binding; hormone activity; neuropeptide hormone activity; protein binding; receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CRH Products

Required fields are marked with *

My Review for All CRH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends