Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human IGF2, StrepII-tagged

Cat.No. : IGF2-212H
Product Overview : Purified, full-length human recombinant IGF2 protein (amino acids 93-126, 34 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 4 kDa. (Accession NP_000603.1; UniProt P01344)
  • Specification
  • Gene Information
  • Related Products
Description : IGF2 is a member of the insulin family of polypeptide growth factors, which are involved in development and growth. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length : 93-126, 34 a.a.
AA Sequence : DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name : IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
Official Symbol : IGF2
Synonyms : IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066;
Gene ID : 3481
mRNA Refseq : NM_000612
Protein Refseq : NP_000603
UniProt ID : P01344
Chromosome Location : 11p15.5
Pathway : Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function : growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; protein serine/threonine kinase activator activity; receptor activator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Can IGF2 be used as a predictive marker for certain diseases? 11/12/2021

Yes, IGF2 levels may serve as predictive markers for certain diseases. Monitoring its expression could help identify individuals at risk or track disease progression.

How can IGF2 be targeted for therapeutic interventions? 04/20/2021

Researchers are exploring various approaches, including drug development, to modulate IGF2 levels for therapeutic purposes. This may involve targeting its receptors or modifying its expression.

How does IGF2 relate to aging and age-related diseases? 12/28/2020

IGF2 has been linked to the aging process and age-related diseases. Exploring its role may provide insights into slowing down aging or managing age-related conditions.

Are there therapeutic applications of IGF2 in regenerative medicine? 12/08/2020

Research is exploring the potential use of IGF2 in regenerative medicine due to its role in cell growth and tissue repair. It may offer new avenues for tissue regeneration.

Are there clinical trials exploring IGF2 as a therapeutic target? 05/21/2019

Yes, there are ongoing clinical trials investigating the use of IGF2 in various conditions. These trials aim to assess its safety and efficacy in a clinical setting.

Customer Reviews (3)

Write a review
Reviews
01/24/2023

    The IGF2 protein is an exceptional choice that meets the highest standards of quality, making it perfectly suited for your experimental needs.

    01/26/2019

      The IGF2 protein is of the highest quality and perfectly suited for your experimental requirements.

      01/20/2019

        In addition to its exceptional quality, the IGF2 protein is backed by excellent technical support offered by the manufacturer.

        Ask a Question for All IGF2 Products

        Required fields are marked with *

        My Review for All IGF2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends