Active Recombinant Human TGFB2, His-tagged

• Cat.No.: TGFB2-22H
• Product Overview: Recombinant Human TGFB2, expressed in Nicotiana benthamiana.

Specification

• Description: TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological pr centigradeesses as embryogenesis, tissue remodelling and wound healing.
• Source: Nicotiana benthamiana
• Species: Human
• Tag: His
• Form: Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
• Bio-activity: The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50< 40ng/ml, corresponding to a specific activity of 25,000>
• Molecular Mass: TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Unit Definition: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.
• Usage: FOR RESEARCH USE ONLY
• Quality Control Test: Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution TGFB2 Human should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
• Reconstitution: It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions.
• Warning: Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
• Official Symbol: TGFB2
• Synonyms: TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892
• Gene ID: 7042
• mRNA Refseq: NM_001135599
• Protein Refseq: NP_001129071
• MIM: 190220
• UniProt ID: P61812
• Chromosome Location: 1q41
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem
• Function: beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding