"mOrange" Related Products

Purified fluorescent protein mOrange

Cat.No.: mOrange-22
Product Overview: Purified fluorescent protein mOrange, with N-terminal HIS tag, expressed in E. coli, 250ug
Source: E. coli
Tag: His
Molecular Mass: 26.7 kDa
AA Sequence: MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPQFTYGSK AYVKHPADIPDYFKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKMRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVEQYERAEGR HSTGGMDELYK
Purity: >80% as determined by SDS-PAGE and Coomassie blue staining
Concentration: >50 ug/mL as determined by microplate BCA method
Storage Buffer: PBS, pH7.4, 10% glycerol.

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.