Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human BCHE

Recombinant Human BCHE

   Share
"BCHE" Related Products.
By Species
Chicken(1)
Equine(2)
Human(10)
Mouse(7)
Rat(2)
+Expand -Collapse
By Tag
His(5)
N/A(2)
Cat.No.:
BCHE-2533H
Product Overview:
Recombinant human butyrylcholinesterase (BChE) produced from conditioned medium of stably-transfected CHO-K1 cells is a tetramer form associated with a proline-rich attachment domain (PRAD). Each mature polypeptide contains 574 amino acids having a predicted molecular mass of approximately 65kD, but migrates with an approximate molecular mass of 280kD in non-reduced SDS gel.
Description:
Butyrylcholinesterase (BCHE, or BuChE), also known as pseudocholinesterase or plasma cholinesterase) is a non-specific cholinesterase enzyme that hydrolyses many different choline esters. In humans, it is found primarily in the liver and is encoded by the BCHE gene.
Source:
CHO-K1 cells
Species:
Human
Form:
20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity:
Butyrylcholinesterase is a serine hydrolase and has a potential role in in maintaining and regulating the activity of neurotransmitter acetylcholine in the central nervous system. Recombinant human BChE protein has similar pharmacokinetic and protective properties to plasma-derived BChE and is suitable for other related function assays.
AA Sequence:
EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFP GFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRV GALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAI LQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD GDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKES ILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEI EFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLR AQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL
Purity:
≥90%, as determined by SDS-PAGE
Usage:
FOR RESEARCH ONLY
Storage:
The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.