"CSTA" Related Products

Expand

Recombinant Human CSTA protein

Cat.No.: CSTA-213H
Product Overview: Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A.
Source: E.coli
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0.
AA Sequence: MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF
Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method.
Purity: > 95 % as determined by SDS-PAGE.
Stability: Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage: Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4oC before opening to recover the entire contents.
Gene Name: CSTA cystatin A [ Homo sapiens ]
Official Symbol: CSTA
Synonyms: AREI; STF1; STFA; cystatin A (stefin A); cystatin AS
Gene ID: 1475
mRNA Refseq: NM_005213
Protein Refseq: NP_005204
MIM: 184600
UniProt ID: P01040
Chromosome Location: 3q21
Function: cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.