Active Recombinant Human Colony Stimulating Factor 1 (Macrophage)
Cat.No. : | CSF1-167H |
Product Overview : | Recombinant Human interleukin 4 encoding the N-terminal 190 amino acids of the human Macrophage Colony-Stimulating Factor 1 (M-CSF) protein and was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
Cat. No. : | CSF1-167H |
Description : | M-CSF (macrophage colony stimulating factor), also known as colony stimulating factor-1 (CSF-1), is a homodimeric glycoprotein the subunits of which are linked by disulfide bonds. Different splice variants of M-CSF have been found which differ at the C-terminus. |
Source : | Human 293 cells. |
Amino Acid Sequence : | EEVSEYCSHMIGSGH LQSLQRLIDSQME TSCQITFEFV DQEQLKDPV CYLKK AFL LV QD I ME DTMR FRDNTPNAIA IVQLQELSLR LK SCFTK DYEEH DKACV RTF YE TPLQL LE K V KNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN. |
Molecular Mass : | Under reducing conditionsM-CSFmigrates as two bands between 20 and 35 kDa in SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified M-CSF that has a predicted molecular mass of 18.4 kDa. |
PI : | M-CSF separates into a number of isoforms with a pI between 3.5 and 5 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified M-CSF that has a predicted pI of 4.8. |
% Carbohydrate : | Purified M-CSF consists of 0–50% carbohydrate by weight. |
Glycosylation : | M-CSF contains N- and O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualised by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilised products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of M-CSF is typically 5–15 ng /ml as measured in a cell proliferation assay using the M-CSF dependent mouse monocytic mNFS-60 cell line. |
Gene Name : | CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ] |
Synonyms : | CSF1; colony stimulating factor 1 (macrophage); MCSF; MGC31930; OTTHUMP00000013363; OTTHUMP00000013364; colony stimulating factor 1; macrophage colony stimulating factor; OTTHUMP00000013362 |
Gene ID : | 1435 |
mRNA Refseq : | NM_000757 |
Protein Refseq : | NP_000748 |
MIM : | 120420 |
UniProt ID : | P09603 |
Chromosome Location : | 1q21-p13 |
Pathway : | Cytokine-cytokine receptor interaction; Hematopoietic cell lineage |
Function : | cytokine activity; growth factor activity; protein binding; macrophage colony stimulating factor receptor binding; protein homodimerization activity |
Products Types
◆ Recombinant Protein | ||
CSF1-41M | Active Recombinant Mouse CSF1 Protein | +Inquiry |
CSF1-1962H | Recombinant Human CSF1 Protein, GST-tagged | +Inquiry |
CSF1-12H | Active Recombinant Human CSF1 Protein, Pre-aliquoted | +Inquiry |
CSF1-2158H | Recombinant Human CSF1 Protein, His-tagged | +Inquiry |
CSF1-3279H | Active Recombinant Human CSF1 protein(Met1-Arg255), His-tagged | +Inquiry |
◆ Lysates | ||
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionCSF1 is implicated in tumor-associated macrophages, influencing tumor growth, invasion, and the tumor microenvironment.
Side effects may include immune-related adverse events, inflammation, and alterations in white blood cell counts.
Yes, there is ongoing research on combining CSF1-targeted therapies with other immunotherapies or conventional treatments to enhance efficacy.
Challenges include maintaining the balance of immune responses, potential off-target effects, and variability in patient responses.
Studies are exploring its role in neuroinflammation, neuroprotection, and potential therapeutic interventions for conditions like Alzheimer's disease.
Customer Reviews (3)
Write a reviewThe CSF1 protein is renowned for its exceptional quality and reliability, making it an ideal choice to fulfill my experimental requirements.
With its high purity and stability, this protein ensures dependable and accurate results, which are crucial for the success of my research endeavors.
Whether it is for investigating cellular pathways, studying protein functions, or exploring signaling cascades, the CSF1 protein offers unparalleled versatility and performance.
Ask a Question for All CSF1 Products
Required fields are marked with *
My Review for All CSF1 Products
Required fields are marked with *
Inquiry Basket