"ABCB7" Related Products

Expand

Recombinant Human ABCB7

Cat.No.: ABCB7-26039TH
Product Overview: Recombinant full length Human ABCB7 with N terminal proprietary tag; Predicted MWt 104.76 kDa.
Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters.ABC proteins transport various molecules across extra- and intra-cellular membranes.ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).This protein is a member of the MDR/TAP subfamily.Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation.This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol.With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis.Mutations in this gene have been implicated in X-linked sideroblastic anemia with ataxia.
Protein length: 715 amino acids
Molecular Weight: 104.760kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQF LDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDT RKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVV PFMFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYG VSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLD LGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFE VMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTR FRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYD GFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLAS QGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQA LIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNV HFEYIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRL LFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVL FHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHG YDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATS SLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEII VLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDN PKWEAKKENISKEEERKKLQEEIVNSVKGCGNCSC
Sequence Similarities: Belongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily.Contains 1 ABC transmembrane type-1 domain.Contains 1 ABC transporter domain.
Gene Name: ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 [ Homo sapiens ]
Official Symbol: ABCB7
Synonyms: ABCB7; ATP-binding cassette, sub-family B (MDR/TAP), member 7; ABC7; ATP-binding cassette sub-family B member 7, mitochondrial; ASAT; Atm1p; EST140535;
Gene ID: 22
mRNA Refseq: NM_004299
Protein Refseq: NP_004290
MIM: 300135
Uniprot ID: O75027
Chromosome Location: Xq13.3
Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Mitochondrial ABC transporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; heme transporter activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.