Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ABCB7

Recombinant Human ABCB7

   Share
"ABCB7" Related Products.
By Species
Human(9)
Mouse(4)
Rat(4)
By Source
By Tag
GST(2)
His(2)
Cat.No.:
ABCB7-26039TH
Product Overview:
Recombinant full length Human ABCB7 with N terminal proprietary tag; Predicted MWt 104.76 kDa.
Description:
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters.ABC proteins transport various molecules across extra- and intra-cellular membranes.ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).This protein is a member of the MDR/TAP subfamily.Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation.This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol.With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis.Mutations in this gene have been implicated in X-linked sideroblastic anemia with ataxia.
Protein length:
715 amino acids
Molecular Weight:
104.760kDa inclusive of tags
Source:
Wheat germ
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
PQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQF LDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDT RKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVV PFMFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYG VSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLD LGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFE VMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTR FRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYD GFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLAS QGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQA LIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNV HFEYIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRL LFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVL FHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHG YDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATS SLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEII VLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDN PKWEAKKENISKEEERKKLQEEIVNSVKGCGNCSC
Sequence Similarities:
Belongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily.Contains 1 ABC transmembrane type-1 domain.Contains 1 ABC transporter domain.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.