Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ABCC6

Recombinant Human ABCC6

   Share
"ABCC6" Related Products.
By Species
Chicken(1)
Human(4)
Mouse(4)
Rat(3)
By Source
By Tag
His(5)
Cat.No.:
ABCC6-29035TH
Product Overview:
Recombinant fragment of Human MRP6 with an N terminal proprietary tag. Predicted MW 36.63 kDa.
Description:
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene.
Protein length:
100 amino acids
Molecular Weight:
36.630kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Expressed in kidney and liver. Very low expression in other tissues.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
Sequence Similarities:
Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.