Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ABLIM1

Recombinant Human ABLIM1

   Share
"ABLIM1" Related Products.
By Species
Chicken(1)
Human(15)
Mouse(9)
By Tag
His(2)
Cat.No.:
ABLIM1-26043TH
Product Overview:
Recombinant full length Human ABLIM1 isoform 4 with a N terminal proprietary tag; Predicted MW 70.18 kDa.
Description:
This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length:
401 amino acids
Molecular Weight:
70.180kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Detected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILD YKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQS LGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYS RHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQ SKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAV VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQL ILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLP GYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMP AMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDR TRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKL F
Sequence Similarities:
Contains 1 HP (headpiece) domain.Contains 4 LIM zinc-binding domains.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.