"ABLIM1" Related Products

Recombinant Human ABLIM1

Cat.No.: ABLIM1-26043TH
Product Overview: Recombinant full length Human ABLIM1 isoform 4 with a N terminal proprietary tag; Predicted MW 70.18 kDa.
Description: This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length: 401 amino acids
Molecular Weight: 70.180kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Detected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILD YKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQS LGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYS RHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQ SKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAV VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQL ILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLP GYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMP AMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDR TRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKL F
Sequence Similarities: Contains 1 HP (headpiece) domain.Contains 4 LIM zinc-binding domains.
Gene Name: ABLIM1 actin binding LIM protein 1 [ Homo sapiens ]
Official Symbol: ABLIM1
Synonyms: ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin;
Gene ID: 3983
mRNA Refseq: NM_001003407
Protein Refseq: NP_001003407
MIM: 602330
Uniprot ID: O14639
Chromosome Location: 10q25
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function: actin binding; metal ion binding; protein binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.