Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ACCN2

Recombinant Human ACCN2

   Share
"ACCN2" Related Products.
By Species
By Source
By Tag
His(2)
Cat.No.:
ACCN2-26289TH
Product Overview:
Recombinant full length Human ACCN2 with N terminal proprietary tag; Predicted MWt 84.15 kDa.
Description:
This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is expressed in most if not all brain neurons, and it may be an ion channel subunit; however, its function as an ion channel remains unknown. Alternative splicing of this gene generates 2 transcript products.
Protein length:
528 amino acids
Molecular Weight:
84.150kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Expressed in most or all neurons.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLS LKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEV AASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDR AGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSG RDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLV ENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQY IGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMG LFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPAR GTFEDFTC
Sequence Similarities:
Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.