"ACCN2" Related Products

Recombinant Human ACCN2

Cat.No.: ACCN2-26289TH
Product Overview: Recombinant full length Human ACCN2 with N terminal proprietary tag; Predicted MWt 84.15 kDa.
Description: This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is expressed in most if not all brain neurons, and it may be an ion channel subunit; however, its function as an ion channel remains unknown. Alternative splicing of this gene generates 2 transcript products.
Protein length: 528 amino acids
Molecular Weight: 84.150kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in most or all neurons.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLS LKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEV AASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDR AGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSG RDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLV ENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQY IGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMG LFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPAR GTFEDFTC
Sequence Similarities: Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily.
Gene Name: ACCN2 amiloride-sensitive cation channel 2, neuronal [ Homo sapiens ]
Official Symbol: ACCN2
Synonyms: ACCN2; amiloride-sensitive cation channel 2, neuronal; ASIC1; BNaC2; hBNaC2;
Gene ID: 41
mRNA Refseq: NM_001095
Protein Refseq: NP_001086
MIM: 602866
Uniprot ID: P78348
Chromosome Location: 12q12
Function: ion channel activity; ligand-gated sodium channel activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.