"ACO2" Related Products

Expand
Expand
Expand

Recombinant Human ACO2, GST-tagged

Cat.No.: ACO2-26478TH
Product Overview: Recombinant full length Human Aconitase 2 with an N-terminal GST tag; Molecular weight 111.2kDa including the tag
Description: The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Protein length: 780 amino acids
Conjugation: GST
Molecular Weight: 111.200kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPN EYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQ EIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAV PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAK YGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGG LGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG WSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGM ATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLAD EFKDHLVPDPGCHYDQLIEINLSELKPHINGPFTPDLAHP VAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVA KQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLG GIVLMAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSH FEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDD PASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLS KVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLAT AGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTP NGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTG SLSGWSSPKDVILKVAGIL
Sequence Similarities: Belongs to the aconitase/IPM isomerase family.
Gene Name: ACO2 aconitase 2, mitochondrial [ Homo sapiens ]
Official Symbol: ACO2
Synonyms: ACO2; aconitase 2, mitochondrial; aconitate hydratase, mitochondrial; ACONM;
Gene ID: 50
mRNA Refseq: NM_001098
Protein Refseq: NP_001089
MIM: 100850
Uniprot ID: Q99798
Chromosome Location: 22q13.2
Pathway: Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
Function: 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; aconitate hydratase activity; citrate hydro-lyase (cis-aconitate-forming) activity; iron ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.