Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ACO2, GST-tagged

Recombinant Human ACO2, GST-tagged

   Share
"ACO2" Related Products.
By Species
+Expand -Collapse
By Source
+Expand -Collapse
By Tag
GST(2)
GST & His(1)
His(4)
His & GST(1)
Cat.No.:
ACO2-26478TH
Product Overview:
Recombinant full length Human Aconitase 2 with an N-terminal GST tag; Molecular weight 111.2kDa including the tag
Description:
The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Protein length:
780 amino acids
Conjugation:
GST
Molecular Weight:
111.200kDa inclusive of tags
Source:
Wheat germ
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPN EYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQ EIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAV PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAK YGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGG LGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG WSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGM ATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLAD EFKDHLVPDPGCHYDQLIEINLSELKPHINGPFTPDLAHP VAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVA KQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLG GIVLMAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSH FEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDD PASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLS KVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLAT AGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTP NGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTG SLSGWSSPKDVILKVAGIL
Sequence Similarities:
Belongs to the aconitase/IPM isomerase family.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.