Recombinant Human ACP1, His-tagged

• Cat.No.: ACP1-26291TH
• Product Overview: Recombinant fragment, corresponding to amino acids 4-158 of Human Acid Phosphatase with a N terminal His tag; 21 kDa.

Specification

• Description: The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 114 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVD SAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKE DFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGS YDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Gene Information

• Gene Name: ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
• Official Symbol: ACP1
• Synonyms: ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase
• Gene ID: 52
• mRNA Refseq: NM_001040649
• Protein Refseq: NP_001035739
• MIM: 171500
• Uniprot ID: P24666
• Chromosome Location: 2p25
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; EPHA2 forward signaling, organism-specific biosystem; PDGFR-beta signaling pathway, organism-specific biosystem; Riboflavin metabolism, organism-specific biosystem
• Function: acid phosphatase activity; hydrolase activity; non-membrane spanning protein tyrosine phosphatase activity; protein binding