Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ACSL3, His-tagged

Cat.No. : ACSL3-26480TH
Product Overview : Recombinant fragment, corresponding to amino acids 535-720 of Human ACSL3 with an N terminal His tag; MWt 25 kDa
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 91 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCL KIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICA YANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCN SCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWT PETGLVTDAFKLKRKELKTHYQADIERMYGRK
Gene Name : ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ]
Official Symbol : ACSL3
Synonyms : ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194;
Gene ID : 2181
mRNA Refseq : NM_004457
Protein Refseq : NP_004448
MIM : 602371
Uniprot ID : O95573
Chromosome Location : 2q34-q35
Pathway : Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem;
Function : ATP binding; fatty-acyl-CoA synthase activity; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
What is the relationship between ACSL3 and cardiovascular disease? 07/18/2022

ACSL3 dysregulation has been linked to the development of cardiovascular disease, highlighting the importance of the gene in the regulation of lipid metabolism and cardiovascular health.

What is the impact of ACSL3 on autophagy? 01/15/2022

ACSL3 has been shown to impact autophagy, a cellular process involved in the breakdown and recycling of damaged or dysfunctional cellular components.

What is the relationship between ACSL3 and insulin resistance? 07/10/2021

ACSL3 dysregulation has been implicated in the development of insulin resistance, a common feature of many metabolic disorders.

What is the impact of ACSL3 on adipogenesis? 01/19/2021

ACSL3 has been shown to impact adipogenesis, the process of fat cell differentiation, by regulating the availability of long-chain fatty acids for lipid synthesis and storage.

What is the structure of the ACSL3 protein? 01/19/2021

The ACSL3 protein consists of multiple domains, including an N-terminal domain, a central domain, and a C-terminal domain, which are involved in substrate binding, acyl-adenylate formation, and ATP binding, respectively.

What is the impact of ACSL3 on cellular signaling pathways? 08/01/2020

ACSL3 has been shown to impact cellular signaling pathways, particularly those involved in the regulation of inflammation, insulin signaling, and energy metabolism.

What is the role of ACSL3 in lipid metabolism? 07/01/2020

ACSL3 plays a critical role in lipid metabolism by activating long-chain fatty acids for subsequent utilization in various metabolic pathways, including β-oxidation and the production of signaling lipids.

What is the expression pattern of ACSL3 in different tissues? 05/20/2020

ACSL3 is expressed in a variety of tissues, including adipose tissue, liver, muscle, heart, and brain, with highest expression levels observed in adipose tissue.

How does ACSL3 impact lipid droplet formation? 04/30/2020

ACSL3 has been shown to impact lipid droplet formation, with increased expression of the gene leading to enhanced lipid droplet formation and storage.

How does ACSL3 impact cellular proliferation and differentiation? 06/03/2018

ACSL3 has been shown to impact cellular proliferation and differentiation by modulating the availability of long-chain fatty acids for various cellular processes.

Customer Reviews (5)

Write a review
Reviews
06/14/2021

    The product was well-characterized, and the documentation provided was thorough and helpful.

    08/27/2020

      The protein arrived quickly and was exactly what I needed for my experiment. Very satisfied with my purchase.

      06/01/2020

        The website was easy to navigate and the ordering process was simple. Appreciate the user-friendly interface.

        10/04/2019

          I'm really pleased with my purchase of the recombinant protein. It's high quality and reasonably priced.

          09/01/2018

            I appreciate the transparency and honesty of this company in their communication with customers. Will continue to order from them in the future.

            Ask a Question for All ACSL3 Products

            Required fields are marked with *

            My Review for All ACSL3 Products

            Required fields are marked with *

            0

            Inquiry Basket

            cartIcon
            logo

            FOLLOW US

            Terms and Conditions        Privacy Policy

            Copyright © 2024 Creative BioMart. All Rights Reserved.

            Contact Us

            • /

            Stay Updated on the Latest Bioscience Trends