"ACTA2" Related Products

Expand
Expand
Expand

Recombinant Human ACTA2

Cat.No.: ACTA2-27340TH
Product Overview: Recombinant full length Human alpha smooth muscle Actin with a proprietary tag at N terminal; MWt 67.21 kDa inclusive of tag.
Description: The protein encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Defects in this gene cause aortic aneurysm familial thoracic type 6. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein length: 377 amino acids
Molecular Weight: 67.210kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVG RPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGII TNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR EKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSG DGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTER GYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL EKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHE TTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKE ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW ISKQEYDEAGPSIVHRKCF
Sequence Similarities: Belongs to the actin family.
Gene Name: ACTA2 actin, alpha 2, smooth muscle, aorta [ Homo sapiens ]
Official Symbol: ACTA2
Synonyms: ACTA2; actin, alpha 2, smooth muscle, aorta; actin, aortic smooth muscle; ACTSA;
Gene ID: 59
mRNA Refseq: NM_001141945
Protein Refseq: NP_001135417
MIM: 102620
Uniprot ID: P62736
Chromosome Location: 10q22-q24
Pathway: Muscle contraction, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem;
Function: ATP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.