Recombinant Human ACTL6B, His-tagged
Cat.No. : | ACTL6B-26300TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa; |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 90 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV |
Gene Name : | ACTL6B actin-like 6B [ Homo sapiens ] |
Official Symbol : | ACTL6B |
Synonyms : | ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; |
Gene ID : | 51412 |
mRNA Refseq : | NM_016188 |
Protein Refseq : | NP_057272 |
MIM : | 612458 |
Uniprot ID : | O94805 |
Chromosome Location : | 7q22 |
Function : | ATP binding; structural constituent of cytoskeleton; transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
ACTL6B-138R | Recombinant Rat ACTL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL6B-51R | Recombinant Rhesus Macaque ACTL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL6B-286M | Recombinant Mouse ACTL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL6B-482R | Recombinant Rat ACTL6B Protein | +Inquiry |
Actl6b-3101R | Recombinant Rat Actl6b, His-tagged | +Inquiry |
◆ Lysates | ||
ACTL6B-9060HCL | Recombinant Human ACTL6B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket