"ACTL7A" Related Products

Expand
Expand

Recombinant Human ACTL7A

Cat.No.: ACTL7A-26590TH
Product Overview: Recombinant full length Human ACTL7A expressed in Saccharomyces cerevisiae; amino acids 1-435, 48.6kDa.
Description: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known.
Form: Liquid
Purity: Immunogen affinity purified
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKR AVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGT GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET FVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTP AMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEG YPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMG IVEDIKKKCCFVALDPIEEKKVPLSEHTIRYVLPDGKEIQ LCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDI ALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDT PQVNVLPERDSAVWTGGSILASLQGFQPLWVHRFEYEE HGPFFLYRRCF
Gene Name: ACTL7A actin-like 7A [ Homo sapiens ]
Official Symbol: ACTL7A
Synonyms: ACTL7A; actin-like 7A; actin-like protein 7A;
Gene ID: 10881
mRNA Refseq: NM_006687
Protein Refseq: NP_006678
MIM: 604303
Uniprot ID: Q9Y615
Chromosome Location: 9q31
Function: structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.