Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ACTL7A

Recombinant Human ACTL7A

   Share
"ACTL7A" Related Products.
By Species
By Source
By Tag
His(4)
Cat.No.:
ACTL7A-26590TH
Product Overview:
Recombinant full length Human ACTL7A expressed in Saccharomyces cerevisiae; amino acids 1-435, 48.6kDa.
Description:
The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known.
Form:
Liquid
Purity:
Immunogen affinity purified
Storage buffer:
Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage:
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids:
MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKR AVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGT GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET FVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTP AMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEG YPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMG IVEDIKKKCCFVALDPIEEKKVPLSEHTIRYVLPDGKEIQ LCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDI ALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDT PQVNVLPERDSAVWTGGSILASLQGFQPLWVHRFEYEE HGPFFLYRRCF


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.