"ADH1C" Related Products

Expand

Recombinant Human ADH1C

Cat.No.: ADH1C-27094TH
Product Overview: Recombinant full length Human ADH1C with N terminal proprietary tag. Predicted MW 67.32 kDa.
Description: This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.
Protein length: 375 amino acids
Molecular Weight: 67.320kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIK MVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAK IDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIF GGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF DLLRSGKSIRTVLTF
Sequence Similarities: Belongs to the zinc-containing alcohol dehydrogenase family.
Gene Name: ADH1C alcohol dehydrogenase 1C (class I), gamma polypeptide [ Homo sapiens ]
Official Symbol: ADH1C
Synonyms: ADH1C; alcohol dehydrogenase 1C (class I), gamma polypeptide; ADH3; alcohol dehydrogenase 1C;
Gene ID: 126
mRNA Refseq: NM_000669
Protein Refseq: NP_000660
MIM: 103730
Uniprot ID: P00326
Chromosome Location: 4q23
Pathway: Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem;
Function: alcohol dehydrogenase (NAD) activity; metal ion binding; nucleotide binding; oxidoreductase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.