"ADORA3" Related Products

Expand
Expand

Recombinant Human ADORA3

Cat.No.: ADORA3-26898TH
Product Overview: Recombinant fragment corresponding to amino acids 121-225 of Human Adenosine A3 Receptor with N terminal proprietary tag; predicted MW: 37.18 kDa, inclusive of tag. P33765, AAH29831.
Description: This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 105 amino acids
Molecular Weight: 37.180kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRN VTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDI FYIIRNKLSLNLSNSKETGAFYGRE
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: ADORA3 adenosine A3 receptor [ Homo sapiens ]
Official Symbol: ADORA3
Synonyms: ADORA3; adenosine A3 receptor; adenosine receptor A3; AD026;
Gene ID: 140
mRNA Refseq: NM_000677
Protein Refseq: NP_000668
MIM: 600445
Uniprot ID: P33765
Chromosome Location: 1p21-p13
Pathway: Adenosine P1 receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function: G-protein coupled adenosine receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.