Recombinant Human ADORA3

• Cat.No.: ADORA3-26898TH
• Product Overview: Recombinant fragment corresponding to amino acids 121-225 of Human Adenosine A3 Receptor with N terminal proprietary tag; predicted MW: 37.18 kDa, inclusive of tag. P33765, AAH29831.

Specification

• Description: This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 105 amino acids
• Molecular Weight: 37.180kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRN VTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDI FYIIRNKLSLNLSNSKETGAFYGRE
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: ADORA3 adenosine A3 receptor [ Homo sapiens ]
• Official Symbol: ADORA3
• Synonyms: ADORA3; adenosine A3 receptor; adenosine receptor A3; AD026
• Gene ID: 140
• mRNA Refseq: NM_000677
• Protein Refseq: NP_000668
• MIM: 600445
• Uniprot ID: P33765
• Chromosome Location: 1p21-p13
• Pathway: Adenosine P1 receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: G-protein coupled adenosine receptor activity; receptor activity; signal transducer activity