"AFF2" Related Products

Recombinant Human AFF2

Cat.No.: AFF2-26444TH
Product Overview: Recombinant fragment of Human AFF2 with N terminal proprietary tag. Predicted MW 37.84 kDa.
Description: This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants.
Protein length: 111 amino acids
Molecular Weight: 37.840kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain (most abundant in hippocampus and amygdala), placenta and lung.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED
Sequence Similarities: Belongs to the AF4 family.
Gene Name: AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
Official Symbol: AFF2
Synonyms: AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE;
Gene ID: 2334
mRNA Refseq: NM_001169122
Protein Refseq: NP_001162593
MIM: 300806
Uniprot ID: P51816
Chromosome Location: Xq28
Function: G-quadruplex RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.