Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human AFG3L2, His-tagged

Cat.No. : AFG3L2-26445TH
Product Overview : Recombinant fragment, corresponding to amino acids 5-169 of Human AFG3L2 with an N terminal His tag. Predicted MWt: 19 kDa;
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVT TQARASRNSLLTDIIAAYQRFCSRPPKGFGKYFPNGKN GKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGRE
Gene Name : AFG3L2 AFG3 ATPase family gene 3-like 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol : AFG3L2
Synonyms : AFG3L2; AFG3 ATPase family gene 3-like 2 (S. cerevisiae); AFG3 (ATPase family gene 3, yeast) like 2 , AFG3 ATPase family gene 3 like 2 (yeast) , SCA28, spinocerebellar ataxia 28; AFG3-like protein 2;
Gene ID : 10939
mRNA Refseq : NM_006796
Protein Refseq : NP_006787
MIM : 604581
Uniprot ID : Q9Y4W6
Chromosome Location : 18p11.21
Function : ATP binding; metal ion binding; metalloendopeptidase activity; nucleoside-triphosphatase activity; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
How does AFG3L2 protein contribute to mitochondrial dynamics, proteostasis, or mitochondrial DNA maintenance, and what are the underlying molecular mechanisms? 11/03/2021

AFG3L2 protein contributes to mitochondrial dynamics, proteostasis, or mitochondrial DNA maintenance, and the underlying molecular mechanisms are currently being investigated.

What is the subcellular localization of AFG3L2 protein, and how can it be experimentally determined? 09/10/2021

The subcellular localization of AFG3L2 protein can be experimentally determined using techniques such as immunofluorescence microscopy or subcellular fractionation.

Are there any genetic variations or mutations in the gene encoding AFG3L2 protein that impact its expression or function, and what are the implications for mitochondrial dysfunction or neurodegenerative diseases? 06/11/2021

Genetic variations or mutations in the gene encoding AFG3L2 protein may impact its expression or function, influencing mitochondrial dysfunction or neurodegenerative diseases.

What experimental techniques or assays have been used to study the functional significance of AFG3L2 protein, such as electron microscopy, protein degradation assays, or animal models? 12/19/2020

Various experimental techniques or assays, such as electron microscopy, protein degradation assays, or animal models, have been used to study the functional significance of AFG3L2 protein.

How does dysregulation or dysfunction of AFG3L2 protein affect mitochondrial homeostasis, cellular energetics, or neurodegenerative disease progression? 06/22/2020

Dysregulation or dysfunction of AFG3L2 protein can disrupt mitochondrial homeostasis, impair cellular energetics, and contribute to neurodegenerative disease progression.

Does AFG3L2 protein interact with specific molecules or participate in protein complexes, and what are the functional implications of these interactions? 04/28/2019

AFG3L2 protein may interact with specific molecules or participate in protein complexes, which have functional implications in cellular processes.

What is the role of AFG3L2 protein in mitochondrial function, protein quality control, or neurodegenerative diseases, and how can its function be investigated experimentally? 07/09/2017

AFG3L2 protein plays a role in mitochondrial function, protein quality control, or neurodegenerative diseases, and its function can be investigated using techniques like electron microscopy, protein degradation assays, or animal models.

Can AFG3L2 protein be targeted or manipulated to modulate mitochondrial function or treat neurodegenerative disorders, and what are the potential implications for therapeutic interventions? 01/29/2017

AFG3L2 protein holds potential as a target for modulating mitochondrial function or treating neurodegenerative disorders, and further research is needed to explore its implications for therapeutic interventions.

How is the expression of AFG3L2 protein regulated, and what factors or signaling pathways control its expression? 02/17/2016

The expression of AFG3L2 protein is regulated by specific factors and signaling pathways.

Are there any known post-translational modifications or regulatory mechanisms that modulate the activity or stability of AFG3L2 protein? 10/18/2015

Post-translational modifications and regulatory mechanisms may modulate the activity or stability of AFG3L2 protein.

Customer Reviews (3)

Write a review
Reviews
07/24/2022

    Deciphering protein-protein interactions in stem cell differentiation for cellular fate determination.

    01/04/2019

      Exploring protein-protein interactions in RNA metabolism for gene expression regulation.

      01/24/2018

        Elucidating protein-protein interactions in neuronal plasticity for learning and memory.

        Ask a Question for All AFG3L2 Products

        Required fields are marked with *

        My Review for All AFG3L2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends