"AFM" Related Products

Expand

Recombinant Human AFM

Cat.No.: AFM-26448TH
Product Overview: Recombinant full length Human AFM with N-terminal proprietary tag. Predicted MW 96.1kDa.
Description: This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Protein length: 599 amino acids
Molecular Weight: 96.100kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIE DNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCM ADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVD AQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRE SLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCE EQNKVNCLQTRAIPVTQYLKAFSSYQKHVCGALLKFGTKV VHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEG DVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPER GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTF FAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTE NPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDG LKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSE EFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFA FRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEE LQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCK AESPEVCFNEESPKIGN
Sequence Similarities: Belongs to the ALB/AFP/VDB family.Contains 3 albumin domains.
Gene Name: AFM afamin [ Homo sapiens ]
Official Symbol: AFM
Synonyms: AFM; afamin; ALB2; ALBA;
Gene ID: 173
mRNA Refseq: NM_001133
Protein Refseq: NP_001124
MIM: 104145
Uniprot ID: P43652
Chromosome Location: 4q13.3
Function: vitamin E binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.