"AFP" Related Products

Recombinant Human AFP

Cat.No.: AFP-27287TH
Product Overview: Recombinant fragment corresponding to amino acids 500-609 of Human alpha 1 Fetoprotein with a proprietary tag; predicited MWt 37.73 kDa inclusive of tag.
Description: This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Plasma. Synthesized by the fetal liver and yolk sac.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Sequence Similarities: Belongs to the ALB/AFP/VDB family.Contains 3 albumin domains.
Gene Name: AFP alpha-fetoprotein [ Homo sapiens ]
Official Symbol: AFP
Synonyms: AFP; alpha-fetoprotein; HPAFP; FETA;
Gene ID: 174
mRNA Refseq: NM_001134
Protein Refseq: NP_001125
Uniprot ID: P02771
Chromosome Location: 4q11-q13
Pathway: Direct p53 effectors, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function: metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.