Recombinant Human AGAP1, His-tagged
Cat.No. : | AGAP1-26447TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII |
Sequence Similarities : | Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain. |
Gene Name : | AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ] |
Official Symbol : | AGAP1 |
Synonyms : | AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099; |
Gene ID : | 116987 |
mRNA Refseq : | NM_014914 |
Protein Refseq : | NP_055729 |
MIM : | 608651 |
Uniprot ID : | Q9UPQ3 |
Chromosome Location : | 2q37 |
Pathway : | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
Function : | ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
AGAP1-536H | Recombinant Human AGAP1 Protein, MYC/DDK-tagged | +Inquiry |
Agap1-1550M | Recombinant Mouse Agap1 Protein, Myc/DDK-tagged | +Inquiry |
AGAP1-0007H | Recombinant Human AGAP1 Protein, GST-Tagged | +Inquiry |
AGAP1-94R | Recombinant Rhesus Macaque AGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGAP1-266R | Recombinant Rhesus monkey AGAP1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
AGAP1-8984HCL | Recombinant Human AGAP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (20)
Ask a questionAGAP1 helps in the inactivation of Arf1 by accelerating its GTP hydrolysis, which is crucial for controlling vesicle trafficking between different cellular compartments.
Currently, there are no widely known drugs specifically targeting AGAP1, but research in this area could have therapeutic implications.
AGAP1 (Arf-GAP with GTPase, Ankyrin repeat, and PH domain 1) is a protein involved in regulating cellular processes like vesicle trafficking and membrane dynamics.
AGAP1 mutations have been associated with certain neurological conditions, potentially affecting neuronal development and function.
AGAP1 is one of several Arf-GAP proteins, each with distinct roles in cellular processes and vesicle trafficking pathways.
AGAP1 interacts with certain signaling molecules and receptors, influencing the transduction of signals within the cell.
The ankyrin repeat domain likely enables AGAP1 to interact with other proteins, contributing to its functional versatility.
AGAP1 has been linked to certain neurological disorders and cancers, but its precise roles in these contexts are still being investigated.
Yes, researchers often use techniques like gene knockdown or overexpression to study AGAP1's effects on cellular processes.
AGAP1 functions as a GTPase-activating protein (GAP) for the small GTPase Arf1, contributing to the regulation of membrane traffic and cellular signaling.
Yes, AGAP1's activity can be influenced by factors like cell stress, changes in membrane composition, and intracellular signaling.
AGAP1's functions are critical for maintaining proper cellular organization, membrane trafficking, and signal transduction, making it an important player in overall cell health.
AGAP1 helps regulate the formation and trafficking of vesicles between different cellular compartments, aiding in the proper distribution of cellular components.
AGAP1 interacts with Arf1, as well as other proteins involved in vesicle trafficking and membrane dynamics.
AGAP1 contains ankyrin repeat and PH (pleckstrin homology) domains, which are involved in protein-protein and protein-lipid interactions, respectively.
AGAP1 is found within cells, specifically in the cytoplasm and associated with membranes.
AGAP1 is expressed in various cell types, but its levels may vary depending on the tissue and cell context.
AGAP1 participates in processes like endocytosis, exocytosis, and maintenance of cellular membrane integrity.
AGAP1 stands for Arf-GAP with GTPase, Ankyrin repeat, and PH domain 1.
AGAP1's activity can be modulated by post-translational modifications, interactions with other proteins, and its localization within the cell.
Customer Reviews (5)
Write a reviewProtein's purity was evident in reproducible gel electrophoresis bands.
The product’s cost-effectiveness and clear instructions facilitated seamless incorporation into our work.
The insights gained from the protein product justified its cost, offering value for money.
It facilitated efficient DNA binding in all tested experimental conditions.
Despite its cost, the product’s contributions to our research goals rendered it an invaluable asset.
Ask a Question for All AGAP1 Products
Required fields are marked with *
My Review for All AGAP1 Products
Required fields are marked with *
Inquiry Basket