"AHR" Related Products

Expand
Expand

Recombinant Human AHR

Cat.No.: AHR-26266TH
Product Overview: Recombinant fragment corresponding to amino acids 721-820 of Human Aryl hydrocarbon Receptor, with a proprietary tag. Predicted MWt 36.63kDa inclusive of tag.
Description: This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa
Source: Wheat germ
Tissue specificity: Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.
Gene Name: AHR aryl hydrocarbon receptor [ Homo sapiens ]
Official Symbol: AHR
Synonyms: AHR; aryl hydrocarbon receptor; bHLHe76;
Gene ID: 196
mRNA Refseq: NM_001621
Protein Refseq: NP_001612
MIM: 600253
Uniprot ID: P35869
Chromosome Location: 7p15
Pathway: Adipogenesis, organism-specific biosystem;
Function: DNA binding; DNA binding; Hsp90 protein binding; ligand-dependent nuclear receptor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.