Recombinant Human AKR1C2
Cat.No. : | AKR1C2-27158TH |
Product Overview : | Recombinant full length Human AKR1C2 with N terminal proprietary tag, MW: 61.53 kDa inclusive of tag. P52895, AAH07024. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
Protein length : | 323 amino acids |
Molecular Weight : | 61.530kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKL AIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLA KSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQR KLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS DEY |
Sequence Similarities : | Belongs to the aldo/keto reductase family. |
Gene Name : | AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ] |
Official Symbol : | AKR1C2 |
Synonyms : | AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2; |
Gene ID : | 1646 |
mRNA Refseq : | NM_001135241 |
Protein Refseq : | NP_001128713 |
MIM : | 600450 |
Uniprot ID : | P52895 |
Chromosome Location : | 10p15-p14 |
Pathway : | Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem; |
Function : | androsterone dehydrogenase (A-specific) activity; bile acid binding; carboxylic acid binding; oxidoreductase activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity; |
Products Types
◆ Recombinant Protein | ||
AKR1C2-01H | Recombinant Human AKR1C2 Protein, DYKDDDDK-tagged | +Inquiry |
AKR1C2-255R | Recombinant Rat AKR1C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C2-858H | Recombinant Human AKR1C2 Protein, His-tagged | +Inquiry |
AKR1C2-456H | Recombinant Human AKR1C2, His tagged | +Inquiry |
AKR1C2-599R | Recombinant Rat AKR1C2 Protein | +Inquiry |
◆ Lysates | ||
AKR1C2-8930HCL | Recombinant Human AKR1C2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket