"ALDOA" Related Products

Expand
Expand

Recombinant Human ALDOA

Cat.No.: ALDOA-26497TH
Product Overview: Recombinant full length Human Aldolase expressed in Saccharomyces cerevisiae; 364 amino acids, MWt 39.4 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGE HTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMV TPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLS GGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASA LKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY
Gene Name: ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ]
Official Symbol: ALDOA
Synonyms: ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A;
Gene ID: 226
mRNA Refseq: NM_000034
Protein Refseq: NP_000025
MIM: 103850
Uniprot ID: P04075
Chromosome Location: 16p11.2
Pathway: Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem;
Function: actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.