"ALOX15" Related Products

Expand

Recombinant Human ALOX15

Cat.No.: ALOX15-26020TH
Product Overview: Recombinant full length Human 15 Lipoxygenase 1 with N terminal proprietary tag; Predicted MWt 98.56 kDa.
Description: Arachidonate 15-lipoxygenase is an enzyme that in humans is encoded by the ALOX15 gene.
Protein length: 662 amino acids
Molecular Weight: 98.560kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW PARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNW ISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDL PVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQL PRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSS FCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVS LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQ ARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIR NAKLDMPYEYLRPSVVENSVAI
Sequence Similarities: Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name: ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ]
Official Symbol: ALOX15
Synonyms: ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1;
Gene ID: 246
mRNA Refseq: NM_001140
Protein Refseq: NP_001131
MIM: 152392
Uniprot ID: P16050
Chromosome Location: 17p13.3
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Linoleic acid metabolism, organism-specific biosystem;
Function: arachidonate 12-lipoxygenase activity; arachidonate 15-lipoxygenase activity; hepoxilin-epoxide hydrolase activity; iron ion binding; lipoxygenase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.