"ALOX15B" Related Products

Expand
Expand

Recombinant Human ALOX15B

Cat.No.: ALOX15B-26021TH
Product Overview: Recombinant fragment of Human 15 Lipoxygenase 2 with N terminal proprietary tag, 36.63kDa inclusive of tag.
Description: This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in hair, prostate, lung and cornea.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
Sequence Similarities: Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name: ALOX15B arachidonate 15-lipoxygenase, type B [ Homo sapiens ]
Official Symbol: ALOX15B
Synonyms: ALOX15B; arachidonate 15-lipoxygenase, type B; arachidonate 15 lipoxygenase, second type; arachidonate 15-lipoxygenase B; 15 LOX 2;
Gene ID: 247
mRNA Refseq: NM_001039130
Protein Refseq: NP_001034219
MIM: 603697
Uniprot ID: O15296
Chromosome Location: 17p13.1
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Selenium Pathway, organism-specific biosystem;
Function: arachidonate 15-lipoxygenase activity; iron ion binding; lipoxygenase activity; metal ion binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.